Lineage for d1ofia_ (1ofi A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 832094Family c.37.1.20: Extended AAA-ATPase domain [81269] (28 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 832226Protein HslU [52721] (2 species)
    ATPase subunit of ATP-dependent protease
  7. 832258Species Haemophilus influenzae [TaxId:727] [52723] (6 PDB entries)
  8. 832276Domain d1ofia_: 1ofi A: [86957]
    Other proteins in same PDB: d1ofig_, d1ofih_, d1ofii_, d1ofil_, d1ofim_, d1ofin_

Details for d1ofia_

PDB Entry: 1ofi (more details), 3.2 Å

PDB Description: asymmetric complex between hslv and i-domain deleted hslu (h. influenzae)
PDB Compounds: (A:) ATP-dependent hsl protease ATP-binding subunit hslu

SCOP Domain Sequences for d1ofia_:

Sequence, based on SEQRES records: (download)

>d1ofia_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}
semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsaggaidaveqngivf
ideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktdhilfiasgafqvar
psdlipelqgrlpirveltalsaadferiltephaslteqykalmategvniafttdavk
kiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayvadalgevve
nedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d1ofia_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}
semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgkevdsiirdltdsaggaidaveqngivfide
idkickdvsregvqrdllplvegstvstkhgmvktdhilfiasgafqvarpsdlipelqg
rlpirveltalsaadferiltephaslteqykalmategvniafttdavkkiaeaafrvn
ektenigarrlhtvmerlmdkisfsasdmngqtvnidaayvadalgevvenedlsrfil

SCOP Domain Coordinates for d1ofia_:

Click to download the PDB-style file with coordinates for d1ofia_.
(The format of our PDB-style files is described here.)

Timeline for d1ofia_: