![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein HslV (ClpQ) protease [56258] (4 species) dodecameric prokaryotic homologue of proteasome |
![]() | Species Haemophilus influenzae [TaxId:727] [56260] (6 PDB entries) |
![]() | Domain d1ofhl_: 1ofh L: [86954] Other proteins in same PDB: d1ofha_, d1ofhb_, d1ofhc_ complexed with adp, mg, po4 |
PDB Entry: 1ofh (more details), 2.5 Å
SCOPe Domain Sequences for d1ofhl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ofhl_ d.153.1.4 (L:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
Timeline for d1ofhl_: