Lineage for d1ofhl_ (1ofh L:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2548926Protein HslV (ClpQ) protease [56258] (4 species)
    dodecameric prokaryotic homologue of proteasome
  7. 2548990Species Haemophilus influenzae [TaxId:727] [56260] (6 PDB entries)
  8. 2549000Domain d1ofhl_: 1ofh L: [86954]
    Other proteins in same PDB: d1ofha_, d1ofhb_, d1ofhc_
    complexed with adp, mg, po4

Details for d1ofhl_

PDB Entry: 1ofh (more details), 2.5 Å

PDB Description: asymmetric complex between hslv and i-domain deleted hslu (h. influenzae)
PDB Compounds: (L:) ATP-dependent protease hslv

SCOPe Domain Sequences for d1ofhl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofhl_ d.153.1.4 (L:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn

SCOPe Domain Coordinates for d1ofhl_:

Click to download the PDB-style file with coordinates for d1ofhl_.
(The format of our PDB-style files is described here.)

Timeline for d1ofhl_: