Lineage for d1ofhc_ (1ofh C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1166163Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 1166295Protein HslU [52721] (2 species)
    ATPase subunit of ATP-dependent protease
  7. 1166327Species Haemophilus influenzae [TaxId:727] [52723] (6 PDB entries)
  8. 1166331Domain d1ofhc_: 1ofh C: [86950]
    Other proteins in same PDB: d1ofhg_, d1ofhh_, d1ofhi_, d1ofhl_, d1ofhm_, d1ofhn_
    complexed with adp, mg, po4

Details for d1ofhc_

PDB Entry: 1ofh (more details), 2.5 Å

PDB Description: asymmetric complex between hslv and i-domain deleted hslu (h. influenzae)
PDB Compounds: (C:) ATP-dependent hsl protease ATP-binding subunit hslu

SCOPe Domain Sequences for d1ofhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofhc_ c.37.1.20 (C:) HslU {Haemophilus influenzae [TaxId: 727]}
semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsaggaidaveqngivf
ideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktdhilfiasgafqvar
psdlipelqgrlpirveltalsaadferiltephaslteqykalmategvniafttdavk
kiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayvadalgevve
nedlsrfil

SCOPe Domain Coordinates for d1ofhc_:

Click to download the PDB-style file with coordinates for d1ofhc_.
(The format of our PDB-style files is described here.)

Timeline for d1ofhc_: