![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
![]() | Protein HslU [52721] (2 species) ATPase subunit of ATP-dependent protease |
![]() | Species Haemophilus influenzae [TaxId:727] [52723] (6 PDB entries) |
![]() | Domain d1ofha_: 1ofh A: [86948] Other proteins in same PDB: d1ofhg_, d1ofhh_, d1ofhi_, d1ofhl_, d1ofhm_, d1ofhn_ complexed with adp, mg, po4 |
PDB Entry: 1ofh (more details), 2.5 Å
SCOPe Domain Sequences for d1ofha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsaggaidaveqngivf ideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktdhilfiasgafqvar psdlipelqgrlpirveltalsaadferiltephaslteqykalmategvniafttdavk kiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayvadalgevve nedlsrfil
Timeline for d1ofha_: