Lineage for d1offa_ (1off A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1018449Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1018450Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 1018451Protein 2Fe-2S ferredoxin [54294] (17 species)
  7. 1018533Species Synechocystis sp. PCC 6803 [TaxId:1148] [54298] (3 PDB entries)
  8. 1018534Domain d1offa_: 1off A: [86947]
    complexed with fes

Details for d1offa_

PDB Entry: 1off (more details), 1.8 Å

PDB Description: 2fe-2s ferredoxin from synechocystis sp. pcc 6803
PDB Compounds: (A:) ferredoxin I

SCOPe Domain Sequences for d1offa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1offa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Synechocystis sp. PCC 6803 [TaxId: 1148]}
asytvklitpdgessiecsddtyildaaeeagldlpyscragacstcagkitagsvdqsd
qsfldddqieagyvltcvayptsdctiethkeedl

SCOPe Domain Coordinates for d1offa_:

Click to download the PDB-style file with coordinates for d1offa_.
(The format of our PDB-style files is described here.)

Timeline for d1offa_: