SCOP 1.75: Domain d1ofeb3: 1ofe B:1-430

Lineage for d1ofeb3 (1ofe B:1-430)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
   has slightly different topology than other families do

6. Protein Alpha subunit of glutamate synthase, N-terminal domain [69833] (2 species)

7. Species Synechocystis sp. [TaxId:1143] [75566] (5 PDB entries)

8. Domain d1ofeb3: 1ofe B:1-430 [86946]
   Other proteins in same PDB: d1ofea1, d1ofea2, d1ofeb1, d1ofeb2
   complexed with 2og, f3s, fmn, onl

Details for d1ofeb3

PDB Entry: 1ofe, 2.45 Å

PDB Description: glutamate synthase from synechocystis sp in complex with 2-oxoglutarate and l-don at 2.45 angstrom resolution

PDB Compounds: (B:) ferredoxin-dependent glutamate synthase 2

SCOP Domain Sequences for d1ofeb3:

Sequence; same for both SEQRES and ATOM records:

>d1ofeb3 d.153.1.1 (B:1-430) Alpha subunit of glutamate synthase, N-terminal domain {Synechocystis sp. [TaxId: 1143]}
cgvgfianlrgkpdhtlveqalkalgcmehrggcsadndsgdgagvmtaiprellaqwfn
trnlpmpdgdrlgvgmvflpqepsarevarayveevvrlekltvlgwrevpvnsdvlgiq
aknnqphieqilvtcpegcagdeldrrlyiarsiigkklaedfyvcsfscrtivykgmvr
siilgefyldlknpgytsnfavyhrrfstntmpkwplaqpmrllghngeintllgninwm
aarekelevsgwtkaelealtpivnqansdsynldsalellvrtgrspleaamilvpeay
knqpalkdypeisdfhdyysglqepwdgpallvfsdgkivgagldrnglrparycitkdd
yivlgseagvvdlpevdivekgrlapgqmiavdlaeqkilknyqikqqaaqkypygewik
iqrqtvasds

Timeline for d1ofeb3:

• d1ofeb3 first appeared in SCOP 1.65
  
• d1ofeb3 appears in SCOP 1.73
  
• d1ofeb3 appears in SCOPe 2.01
  
• d1ofeb3 appears in the current release, SCOPe 2.08