Lineage for d1ofeb3 (1ofe B:1-430)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 612721Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 612722Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 612723Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
    has slightly different topology than other families do
  6. 612724Protein Alpha subunit of glutamate synthase, N-terminal domain [69833] (2 species)
  7. 612728Species Synechocystis sp. [TaxId:1143] [75566] (5 PDB entries)
  8. 612732Domain d1ofeb3: 1ofe B:1-430 [86946]
    Other proteins in same PDB: d1ofea1, d1ofea2, d1ofeb1, d1ofeb2
    complexed with 2og, f3s, fmn, onl

Details for d1ofeb3

PDB Entry: 1ofe (more details), 2.45 Å

PDB Description: glutamate synthase from synechocystis sp in complex with 2-oxoglutarate and l-don at 2.45 angstrom resolution

SCOP Domain Sequences for d1ofeb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofeb3 d.153.1.1 (B:1-430) Alpha subunit of glutamate synthase, N-terminal domain {Synechocystis sp.}
cgvgfianlrgkpdhtlveqalkalgcmehrggcsadndsgdgagvmtaiprellaqwfn
trnlpmpdgdrlgvgmvflpqepsarevarayveevvrlekltvlgwrevpvnsdvlgiq
aknnqphieqilvtcpegcagdeldrrlyiarsiigkklaedfyvcsfscrtivykgmvr
siilgefyldlknpgytsnfavyhrrfstntmpkwplaqpmrllghngeintllgninwm
aarekelevsgwtkaelealtpivnqansdsynldsalellvrtgrspleaamilvpeay
knqpalkdypeisdfhdyysglqepwdgpallvfsdgkivgagldrnglrparycitkdd
yivlgseagvvdlpevdivekgrlapgqmiavdlaeqkilknyqikqqaaqkypygewik
iqrqtvasds

SCOP Domain Coordinates for d1ofeb3:

Click to download the PDB-style file with coordinates for d1ofeb3.
(The format of our PDB-style files is described here.)

Timeline for d1ofeb3: