Lineage for d1ofea1 (1ofe A:1240-1507)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079406Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2079618Superfamily b.80.4: Alpha subunit of glutamate synthase, C-terminal domain [69336] (1 family) (S)
  5. 2079619Family b.80.4.1: Alpha subunit of glutamate synthase, C-terminal domain [69337] (1 protein)
    this is a repeat family; one repeat unit is 1ea0 A:1280-1300 found in domain
  6. 2079620Protein Alpha subunit of glutamate synthase, C-terminal domain [69338] (2 species)
    Central domain (residues 423-780) may be a rudiment form of the FMN domain
  7. 2079630Species Synechocystis sp. [TaxId:1143] [75027] (5 PDB entries)
  8. 2079633Domain d1ofea1: 1ofe A:1240-1507 [86941]
    Other proteins in same PDB: d1ofea2, d1ofea3, d1ofeb2, d1ofeb3
    complexed with akg, f3s, fmn, onl

Details for d1ofea1

PDB Entry: 1ofe (more details), 2.45 Å

PDB Description: glutamate synthase from synechocystis sp in complex with 2-oxoglutarate and l-don at 2.45 angstrom resolution
PDB Compounds: (A:) ferredoxin-dependent glutamate synthase 2

SCOPe Domain Sequences for d1ofea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofea1 b.80.4.1 (A:1240-1507) Alpha subunit of glutamate synthase, C-terminal domain {Synechocystis sp. [TaxId: 1143]}
vhsngpvldddiladpdiqeainhqttatktyrlvntdrtvgtrlsgaiakkygnngfeg
nitlnfqgaagqsfgafnldgmtlhlqgeandyvgkgmnggeivivphpqasfapednvi
igntclygatggnlyangragerfavrnsvgkaviegagdhcceymtggvivvlgpvgrn
vgagmtgglayfldevgdlpekinpeiitlqritaskgeeqlkslitahvehtgspkgka
ilanwsdylgkfwqavppsekdspeann

SCOPe Domain Coordinates for d1ofea1:

Click to download the PDB-style file with coordinates for d1ofea1.
(The format of our PDB-style files is described here.)

Timeline for d1ofea1: