SCOP 1.65: Domain d1ofdb1: 1ofd B:1240-1507

Lineage for d1ofdb1 (1ofd B:1240-1507)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (5 superfamilies)
   superhelix with each turn made by 3 strands with short links
   duplication: turns of the helix are structural repeats

4. Superfamily b.80.4: Alpha subunit of glutamate synthase, C-terminal domain [69336] (1 family)

5. Family b.80.4.1: Alpha subunit of glutamate synthase, C-terminal domain [69337] (1 protein)
   this is a repeat family; one repeat unit is 1ea0 A:1280-1300 found in domain

6. Protein Alpha subunit of glutamate synthase, C-terminal domain [69338] (2 species)
   Central domain (residues 423-780) may be a rudiment form of the FMN domain

7. Species Synechocystis sp. [TaxId:1143] [75027] (5 PDB entries)

8. Domain d1ofdb1: 1ofd B:1240-1507 [86938]
   Other proteins in same PDB: d1ofda2, d1ofda3, d1ofdb2, d1ofdb3
   complexed with 2og, f3s, fmn

Details for d1ofdb1

PDB Entry: 1ofd, 2 Å

PDB Description: glutamate synthase from synechocystis sp in complex with 2-oxoglutarate at 2.0 angstrom resolution

SCOP Domain Sequences for d1ofdb1:

Sequence; same for both SEQRES and ATOM records:

>d1ofdb1 b.80.4.1 (B:1240-1507) Alpha subunit of glutamate synthase, C-terminal domain {Synechocystis sp.}
vhsngpvldddiladpdiqeainhqttatktyrlvntdrtvgtrlsgaiakkygnngfeg
nitlnfqgaagqsfgafnldgmtlhlqgeandyvgkgmnggeivivphpqasfapednvi
igntclygatggnlyangragerfavrnsvgkaviegagdhcceymtggvivvlgpvgrn
vgagmtgglayfldevgdlpekinpeiitlqritaskgeeqlkslitahvehtgspkgka
ilanwsdylgkfwqavppsekdspeann

Timeline for d1ofdb1:

• d1ofdb1 is new in SCOP 1.65
  
• d1ofdb1 appears in SCOP 1.67
  
• d1ofdb1 appears in the current release, SCOPe 2.08