Lineage for d1ofda2 (1ofd A:431-1239)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080028Protein Alpha subunit of glutamate synthase, central and FMN domains [69381] (2 species)
    Central domain (residues 423-780) may be a rudiment form of the FMN domain
  7. 2080038Species Synechocystis sp. [TaxId:1143] [75055] (5 PDB entries)
  8. 2080039Domain d1ofda2: 1ofd A:431-1239 [86936]
    Other proteins in same PDB: d1ofda1, d1ofda3, d1ofdb1, d1ofdb3
    complexed with akg, f3s, fmn

Details for d1ofda2

PDB Entry: 1ofd (more details), 2 Å

PDB Description: glutamate synthase from synechocystis sp in complex with 2-oxoglutarate at 2.0 angstrom resolution
PDB Compounds: (A:) ferredoxin-dependent glutamate synthase 2

SCOPe Domain Sequences for d1ofda2:

Sequence, based on SEQRES records: (download)

>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]}
faektlfndaqtvlqqqaafgytaedvemvvvpmasqgkeptfcmgddtplavlshkprl
lydyfkqrfaqvtnppidplrenlvmslamflgkrgnllepkaesartiklrsplvneve
lqaiktgqlqvaevstlydldgvnsledaltnlvktaiatvqagaeilvltdrpngailt
enqsfippllavgavhhhliraglrlkaslivdtaqcwsthhfaclvgygasaicpylal
esvrqwwldektqklmengrldridlptalknyrqsveaglfkilskmgisllasyhgaq
ifeaiglgaelveyafagttsrvggltiadvagevmvfhgmafpemakklenfgfvnyrp
ggeyhmnspemskslhkavaaykvggngnngeaydhyelyrqylkdrpvtalrdlldfna
dqpaisleevesvesivkrfctggmslgalsreahetlaiamnrlgaksnsgeggedvvr
yltlddvdsegnsptlphlhglqngdtansaikqiasgrfgvtpeylmsgkqleikmaqg
akpgeggqlpgkkvseyiamlrrskpgvtlisppphhdiysiedlaqliydlhqinpeaq
vsvklvaeigigtiaagvakanadiiqisghdggtgasplssikhagspwelgvtevhrv
lmenqlrdrvllradgglktgwdvvmaalmgaeeygfgsiamiaegcimarvchtnncpv
gvatqqerlrqrfkgvpgqvvnffyfiaeevrsllahlgyrslddiigrtdllkvrsdvq
lsktqnltldcllnlpdtkqnrqwlnhep

Sequence, based on observed residues (ATOM records): (download)

>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]}
faektlfndaqtvlqqqaafgytaedvemvvvpmasqgkeptfcmgddtplavlshkprl
lydyfkqrfaqvtnppidplrenlvmslamflgkrgnllepkaesartiklrsplvneve
lqaiktgqlqvaevstlydldgvnsledaltnlvktaiatvqagaeilvltdrpngailt
enqsfippllavgavhhhliraglrlkaslivdtaqcwsthhfaclvgygasaicpylal
esvrqwwldektqklmengrldridlptalknyrqsveaglfkilskmgisllasyhgaq
ifeaiglgaelveyafagttsrvggltiadvagevmvfhgmafkklenfgfvnyrpggey
hmnspemskslhkavaaydhyelyrqylkdrpvtalrdlldfnadqpaisleevesvesi
vkrfctggmslgalsreahetlaiamnrlgaksnsgeggedvvryltlddvdsegnsptl
phlhglqngdtansaikqiasgrfgvtpeylmsgkqleikmaqgakpgeggqlpgkkvse
yiamlrrskpgvtlisppphhdiysiedlaqliydlhqinpeaqvsvklvaeigigtiaa
gvakanadiiqisghdggtgasplssikhagspwelgvtevhrvlmenqlrdrvllradg
glktgwdvvmaalmgaeeygfgsiamiaegcimarvchtnncpvgvatqqerlrqrfkgv
pgqvvnffyfiaeevrsllahlgyrslddiigrtdllkvrsdvqlsktqnltldcllnlp
dtkqnrqwlnhep

SCOPe Domain Coordinates for d1ofda2:

Click to download the PDB-style file with coordinates for d1ofda2.
(The format of our PDB-style files is described here.)

Timeline for d1ofda2: