SCOPe 2.01: Domain d1of5b_: 1of5 B:

Lineage for d1of5b_ (1of5 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.2: NTF2-like [54431] (6 proteins)

6. Protein mRNA transport regulator MTR2 [89849] (2 species)
   similar to p15; forms complex with MEX67 similar to the TAP-p15 complex

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89850] (1 PDB entry)
   Ykl186C

8. Domain d1of5b_: 1of5 B: [86934]
   Other proteins in same PDB: d1of5a_
   complexed with hg

Details for d1of5b_

PDB Entry: 1of5, 2.8 Å

PDB Description: crystal structure of mex67-mtr2

PDB Compounds: (B:) mRNA transport regulator mtr2

SCOPe Domain Sequences for d1of5b_:

Sequence, based on SEQRES records:

>d1of5b_ d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nqaqitatftkkilahlddpdsnklaqfvqlfnpnncriifnatpfaqatvflqmwqnqv
vqtqhaltgvdyhaipgsgtlicnvnckvrfdesgrdkmgqdatvpiqpnntgnrnrpnd
mnkprplwgpyfgislqliiddrifrndfngvisgfnynmvykpe

Sequence, based on observed residues (ATOM records):

>d1of5b_ d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nqaqitatftkkilahlddpdsnlaqfvqlfnpncriifnatpfaqatvflqmwqnqvvq
tqhaltgvdyhaipgsgtlicnvnckvrfdwgpyfgislqliiddrifrndfngvisgfn
ynmvykpe

Timeline for d1of5b_:

• d1of5b_ first appeared in SCOP 1.65
  
• d1of5b_ appears in SCOP 1.75
  
• d1of5b_ appears in SCOPe 2.02
  
• d1of5b_ appears in the current release, SCOPe 2.08