![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.2: NTF2-like [54431] (6 proteins) |
![]() | Protein mRNA transport regulator MTR2 [89849] (2 species) similar to p15; forms complex with MEX67 similar to the TAP-p15 complex |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89850] (1 PDB entry) Ykl186C |
![]() | Domain d1of5b_: 1of5 B: [86934] Other proteins in same PDB: d1of5a1, d1of5a2 complexed with hg |
PDB Entry: 1of5 (more details), 2.8 Å
SCOPe Domain Sequences for d1of5b_:
Sequence, based on SEQRES records: (download)
>d1of5b_ d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nqaqitatftkkilahlddpdsnklaqfvqlfnpnncriifnatpfaqatvflqmwqnqv vqtqhaltgvdyhaipgsgtlicnvnckvrfdesgrdkmgqdatvpiqpnntgnrnrpnd mnkprplwgpyfgislqliiddrifrndfngvisgfnynmvykpe
>d1of5b_ d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nqaqitatftkkilahlddpdsnlaqfvqlfnpncriifnatpfaqatvflqmwqnqvvq tqhaltgvdyhaipgsgtlicnvnckvrfdwgpyfgislqliiddrifrndfngvisgfn ynmvykpe
Timeline for d1of5b_: