SCOPe 2.06: Domain d1of5a1: 1of5 A:268-484

Lineage for d1of5a1 (1of5 A:268-484)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.2: NTF2-like [54431] (6 proteins)

6. Protein NTF2-like domain of mRNA export factor MEX67 [89847] (2 species)
   similar to the TAP domain; forms complex with MTR2 similar to the TAP-p15 complex

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89848] (1 PDB entry)
   Ypl169C

8. Domain d1of5a1: 1of5 A:268-484 [86933]
   Other proteins in same PDB: d1of5a2, d1of5b_
   complexed with hg

Details for d1of5a1

PDB Entry: 1of5, 2.8 Å

PDB Description: crystal structure of mex67-mtr2

PDB Compounds: (A:) mRNA export factor mex67

SCOPe Domain Sequences for d1of5a1:

Sequence, based on SEQRES records:

>d1of5a1 d.17.4.2 (A:268-484) NTF2-like domain of mRNA export factor MEX67 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qqfffendalgqsstdfatnflnlwdnnreqllnlyspqsqfsvsvdstippstvtdsdq
tpafgyymsssrniskvsseksiqqrlsigqesinsifktlpktkhhlqeqpneysmeti
sypqingfvitlhgffeetgkpelesnkktgknnyqknrrynhgynstsnnklskksfdr
twvivpmnnsviiasdlltvraystgawktasiaiaq

Sequence, based on observed residues (ATOM records):

>d1of5a1 d.17.4.2 (A:268-484) NTF2-like domain of mRNA export factor MEX67 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qqfffendalgqsstdfatnflnlwdnnreqllnlyspqsqfsvsvdstsigqesinsif
ktlpktkhhlqeqpneysmetisypqingfvitlhgffeetsnnklskksfdrtwvivpm
nnsviiasdlltvraystgawktasiaiaq

Timeline for d1of5a1:

• d1of5a1 first appeared in SCOP 1.65, called d1of5a_
  
• d1of5a1 was called d1of5a_ in SCOPe 2.05
  
• d1of5a1 appears in SCOPe 2.07
  
• d1of5a1 appears in the current release, SCOPe 2.08