Class b: All beta proteins [48724] (177 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.18: Family 27 carbohydrate binding module, CBM27 [89241] (2 proteins) |
Protein Beta-mannosidase, C-terminal domain [89242] (1 species) |
Species Thermotoga maritima [TaxId:2336] [89243] (3 PDB entries) |
Domain d1of4a_: 1of4 A: [86932] complexed with ca, gol |
PDB Entry: 1of4 (more details), 1.6 Å
SCOPe Domain Sequences for d1of4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1of4a_ b.18.1.18 (A:) Beta-mannosidase, C-terminal domain {Thermotoga maritima [TaxId: 2336]} aryvlaeevdfsspeevknwwnsgtwqaefgspdiewngevgngalqlnvklpgksdwee vrvarkferlseceileydiyipnveglkgrlrpyavlnpgwvkigldmnnanvesaeii tfggkeyrrfhvriefdrtagvkelhigvvgdhlrydgpifidnvrlykrt
Timeline for d1of4a_: