Lineage for d1of4a_ (1of4 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2046932Family b.18.1.18: Family 27 carbohydrate binding module, CBM27 [89241] (2 proteins)
  6. 2046937Protein Beta-mannosidase, C-terminal domain [89242] (1 species)
  7. 2046938Species Thermotoga maritima [TaxId:2336] [89243] (3 PDB entries)
  8. 2046940Domain d1of4a_: 1of4 A: [86932]
    complexed with ca, gol

Details for d1of4a_

PDB Entry: 1of4 (more details), 1.6 Å

PDB Description: structural and thermodynamic dissection of specific mannan recognition by a carbohydrate-binding module, tmcbm27
PDB Compounds: (A:) beta-mannosidase

SCOPe Domain Sequences for d1of4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1of4a_ b.18.1.18 (A:) Beta-mannosidase, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
aryvlaeevdfsspeevknwwnsgtwqaefgspdiewngevgngalqlnvklpgksdwee
vrvarkferlseceileydiyipnveglkgrlrpyavlnpgwvkigldmnnanvesaeii
tfggkeyrrfhvriefdrtagvkelhigvvgdhlrydgpifidnvrlykrt

SCOPe Domain Coordinates for d1of4a_:

Click to download the PDB-style file with coordinates for d1of4a_.
(The format of our PDB-style files is described here.)

Timeline for d1of4a_: