SCOPe 2.01: Domain d1oepa1: 1oep A:139-429

Lineage for d1oepa1 (1oep A:139-429)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.1: Enolase [51605] (1 protein)

6. Protein Enolase [51606] (8 species)
   Fold of this protein slightly differs from common fold in topology

7. Species Trypanosoma brucei brucei [TaxId:5702] [89497] (1 PDB entry)

8. Domain d1oepa1: 1oep A:139-429 [86918]
   Other proteins in same PDB: d1oepa2
   complexed with edo, so4, zn

Details for d1oepa1

PDB Entry: 1oep, 2.3 Å

PDB Description: structure of trypanosoma brucei enolase reveals the inhibitory divalent metal site

PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d1oepa1:

Sequence, based on SEQRES records:

>d1oepa1 c.1.11.1 (A:139-429) Enolase {Trypanosoma brucei brucei [TaxId: 5702]}
kelrlpvpcfnvinggkhagnalpfqefmiapvkatsfsealrmgsevyhslkgiikkky
gqdavnvgdeggfappikdineplpilmeaieeaghrgkfaicmdcaasetydekkqqyn
ltfkspeptwvtaeqlretyckwahdypivsiedpydqddfagfagitealkgktqivgd
dltvtnterikmaiekkacnslllkinqigtiseaiassklcmengwsvmvshrsgeted
tyiadlvvalgsgqiktgapcrgertaklnqllrieeelgahakfgfpgws

Sequence, based on observed residues (ATOM records):

>d1oepa1 c.1.11.1 (A:139-429) Enolase {Trypanosoma brucei brucei [TaxId: 5702]}
kelrlpvpcfnvinggkhagnalpfqefmiapvkatsfsealrmgsevyhslkgiikkky
gqdavnvgdeggfappikdineplpilmeaieeaghrgkfaicmdcaasetydekkqqyn
ltwvtaeqlretyckwahdypivsiedpydqddfagfagitealkgktqivgddltvtnt
erikmaiekkacnslllkinqigtiseaiassklcmengwsvmvshrsgetedtyiadlv
valgsgqiktgapcrgertaklnqllrieeelgahakfgfpgws

Timeline for d1oepa1:

• d1oepa1 first appeared in SCOP 1.65
  
• d1oepa1 appears in SCOP 1.75
  
• d1oepa1 appears in SCOPe 2.02
  
• d1oepa1 appears in the current release, SCOPe 2.08