SCOP 1.69: Domain d1oeox_: 1oeo X:

Lineage for d1oeox_ (1oeo X:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (5 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (7 species)

7. Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (62 PDB entries)

8. Domain d1oeox_: 1oeo X: [86917]

Details for d1oeox_

PDB Entry: 1oeo, 2.15 Å

PDB Description: ptp1b with the catalytic cysteine oxidized to sulfonic acid

SCOP Domain Sequences for d1oeox_:

Sequence; same for both SEQRES and ATOM records:

>d1oeox_ c.45.1.2 (X:) Tyrosine phosphatase {Human (Homo sapiens), 1B}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim

Timeline for d1oeox_:

• d1oeox_ first appeared in SCOP 1.65
  
• d1oeox_ appears in SCOP 1.67
  
• d1oeox_ appears in SCOP 1.71
  
• d1oeox_ appears in the current release, SCOPe 2.08