Lineage for d1oedc_ (1oed C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028193Fold f.36: Neurotransmitter-gated ion-channel transmembrane pore [90111] (1 superfamily)
    heteropentameric transmembrane alpha-helical protein; 4 transmembrane helices per subunit
  4. 3028194Superfamily f.36.1: Neurotransmitter-gated ion-channel transmembrane pore [90112] (1 family) (S)
  5. 3028195Family f.36.1.1: Neurotransmitter-gated ion-channel transmembrane pore [90113] (4 proteins)
  6. 3028203Protein Acetylcholine receptor protein, delta chain [90118] (1 species)
  7. 3028204Species Marbled electric ray (Torpedo marmorata) [TaxId:7788] [90119] (1 PDB entry)
  8. 3028205Domain d1oedc_: 1oed C: [86913]
    Other proteins in same PDB: d1oeda_, d1oedb_, d1oedd_, d1oede_

Details for d1oedc_

PDB Entry: 1oed (more details), 4 Å

PDB Description: structure of acetylcholine receptor pore from electron images
PDB Compounds: (C:) acetylcholine receptor delta subunit

SCOPe Domain Sequences for d1oedc_:

Sequence, based on SEQRES records: (download)

>d1oedc_ f.36.1.1 (C:) Acetylcholine receptor protein, delta chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]}
plfyvinfitpcvlisflaslafylpaesgekmstaisvllaqavfllltsqrlpetala
vpligkylmfimslvtgvivncgivlnfhfrtpsthvlstrvkqifleklprilhmsrad
eseqpdwqndlklrrsssvgyiskaqeyfniksrselmfekqserhglvprvtprigfgn
nneniaasdqlhdeiksgidstnyivkqikeknaydeevgnwnlvgqtidrlsmfiitpv
mvlgtififvmgnfnhppak

Sequence, based on observed residues (ATOM records): (download)

>d1oedc_ f.36.1.1 (C:) Acetylcholine receptor protein, delta chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]}
plfyvinfitpcvlisflaslafylpaesgekmstaisvllaqavfllltsqrlpetala
vpligkylmfimslvtgvivncgivlnfhfrtgqtidrlsmfiitpvmvlgtififvmgn
fnhppak

SCOPe Domain Coordinates for d1oedc_:

Click to download the PDB-style file with coordinates for d1oedc_.
(The format of our PDB-style files is described here.)

Timeline for d1oedc_: