Class f: Membrane and cell surface proteins and peptides [56835] (36 folds) |
Fold f.36: Neurotransmitter-gated ion-channel pransmembrane pore [90111] (1 superfamily) hetropentameric transmembrane alpha-helical protein; 4 transmembrane helices per subunit |
Superfamily f.36.1: Neurotransmitter-gated ion-channel pransmembrane pore [90112] (1 family) |
Family f.36.1.1: Neurotransmitter-gated ion-channel pransmembrane pore [90113] (4 proteins) |
Protein Acetylcholine receptor protein, beta chain [90116] (1 species) |
Species Marbled electric ray (Torpedo marmorata) [TaxId:7788] [90117] (1 PDB entry) |
Domain d1oedb_: 1oed B: [86912] Other proteins in same PDB: d1oeda_, d1oedc_, d1oedd_, d1oede_ |
PDB Entry: 1oed (more details), 4 Å
SCOP Domain Sequences for d1oedb_:
Sequence, based on SEQRES records: (download)
>d1oedb_ f.36.1.1 (B:) Acetylcholine receptor protein, beta chain {Marbled electric ray (Torpedo marmorata)} plfyivytiipcilisilailvfylppdagekmslsisallavtvflllladkvpetsls vpiiirylmfimilvafsvilsvvvlnlhhrspnthtmpnwirqifietlppflwiqrpv ttpspdskptiisrandeyfirkpagdfvcpvdnarvavqperlfsemkwhlngltqpvt lpqdlkeaveaikyiaeqlesasefddlkkdwqyvamvadrlflyvffvicsigtfsifl dashnvppdn
>d1oedb_ f.36.1.1 (B:) Acetylcholine receptor protein, beta chain {Marbled electric ray (Torpedo marmorata)} plfyivytiipcilisilailvfylppdagekmslsisallavtvflllladkvpetsls vpiiirylmfimilvafsvilsvvvlnlhhrsamvadrlflyvffvicsigtfsifldas hnvppdn
Timeline for d1oedb_:
View in 3D Domains from other chains: (mouse over for more information) d1oeda_, d1oedc_, d1oedd_, d1oede_ |