Lineage for d1oedb_ (1oed B:)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 341298Fold f.36: Neurotransmitter-gated ion-channel pransmembrane pore [90111] (1 superfamily)
    hetropentameric transmembrane alpha-helical protein; 4 transmembrane helices per subunit
  4. 341299Superfamily f.36.1: Neurotransmitter-gated ion-channel pransmembrane pore [90112] (1 family) (S)
  5. 341300Family f.36.1.1: Neurotransmitter-gated ion-channel pransmembrane pore [90113] (4 proteins)
  6. 341305Protein Acetylcholine receptor protein, beta chain [90116] (1 species)
  7. 341306Species Marbled electric ray (Torpedo marmorata) [TaxId:7788] [90117] (1 PDB entry)
  8. 341307Domain d1oedb_: 1oed B: [86912]
    Other proteins in same PDB: d1oeda_, d1oedc_, d1oedd_, d1oede_

Details for d1oedb_

PDB Entry: 1oed (more details), 4 Å

PDB Description: structure of acetylcholine receptor pore from electron images

SCOP Domain Sequences for d1oedb_:

Sequence, based on SEQRES records: (download)

>d1oedb_ f.36.1.1 (B:) Acetylcholine receptor protein, beta chain {Marbled electric ray (Torpedo marmorata)}
plfyivytiipcilisilailvfylppdagekmslsisallavtvflllladkvpetsls
vpiiirylmfimilvafsvilsvvvlnlhhrspnthtmpnwirqifietlppflwiqrpv
ttpspdskptiisrandeyfirkpagdfvcpvdnarvavqperlfsemkwhlngltqpvt
lpqdlkeaveaikyiaeqlesasefddlkkdwqyvamvadrlflyvffvicsigtfsifl
dashnvppdn

Sequence, based on observed residues (ATOM records): (download)

>d1oedb_ f.36.1.1 (B:) Acetylcholine receptor protein, beta chain {Marbled electric ray (Torpedo marmorata)}
plfyivytiipcilisilailvfylppdagekmslsisallavtvflllladkvpetsls
vpiiirylmfimilvafsvilsvvvlnlhhrsamvadrlflyvffvicsigtfsifldas
hnvppdn

SCOP Domain Coordinates for d1oedb_:

Click to download the PDB-style file with coordinates for d1oedb_.
(The format of our PDB-style files is described here.)

Timeline for d1oedb_: