Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.36: Neurotransmitter-gated ion-channel transmembrane pore [90111] (1 superfamily) heteropentameric transmembrane alpha-helical protein; 4 transmembrane helices per subunit |
Superfamily f.36.1: Neurotransmitter-gated ion-channel transmembrane pore [90112] (1 family) |
Family f.36.1.1: Neurotransmitter-gated ion-channel transmembrane pore [90113] (4 proteins) |
Protein Acetylcholine receptor protein, alpha chain [90114] (1 species) |
Species Marbled electric ray (Torpedo marmorata) [TaxId:7788] [90115] (1 PDB entry) |
Domain d1oeda_: 1oed A: [86911] Other proteins in same PDB: d1oedb_, d1oedc_, d1oede_ |
PDB Entry: 1oed (more details), 4 Å
SCOPe Domain Sequences for d1oeda_:
Sequence, based on SEQRES records: (download)
>d1oeda_ f.36.1.1 (A:) Acetylcholine receptor protein, alpha chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} plyfvvnviipcllfsfltglvfylptdsgekmtlsisvllsltvfllvivelipstssa vpligkymlftmifvissiiitvvvinthhrspsthtmpqwvrkifidtipnvmffstmk raskekqenkifaddidisdisgkqvtgevifqtpliknpdvksaiegvkyiaehmksde essnaaeewkyvamvidhillcvfmliciigtvsvfagrlielsqeg
>d1oeda_ f.36.1.1 (A:) Acetylcholine receptor protein, alpha chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} plyfvvnviipcllfsfltglvfylptdsgekmtlsisvllsltvfllvivelipstssa vpligkymlftmifvissiiitvvvinthhrsamvidhillcvfmliciigtvsvfagrl ielsqeg
Timeline for d1oeda_:
View in 3D Domains from other chains: (mouse over for more information) d1oedb_, d1oedc_, d1oedd_, d1oede_ |