Lineage for d1oeba_ (1oeb A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461193Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 461236Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 461237Family b.34.2.1: SH3-domain [50045] (35 proteins)
  6. 461359Protein Grb2-related adaptor protein 2 (Mona/Gads) [89293] (1 species)
  7. 461360Species Mouse (Mus musculus) [TaxId:10090] [89294] (3 PDB entries)
  8. 461362Domain d1oeba_: 1oeb A: [86909]

Details for d1oeba_

PDB Entry: 1oeb (more details), 1.76 Å

PDB Description: mona/gads sh3c domain

SCOP Domain Sequences for d1oeba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oeba_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus)}
plgsvrwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvap

SCOP Domain Coordinates for d1oeba_:

Click to download the PDB-style file with coordinates for d1oeba_.
(The format of our PDB-style files is described here.)

Timeline for d1oeba_:

461362
d1oeba_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1oebb_