SCOP 1.65: Domain d1oe8b2: 1oe8 B:3-84

Lineage for d1oe8b2 (1oe8 B:3-84)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89704] (2 PDB entries)

8. Domain d1oe8b2: 1oe8 B:3-84 [86908]
   Other proteins in same PDB: d1oe8a1, d1oe8b1
   complexed with gsh

Details for d1oe8b2

PDB Entry: 1oe8, 1.65 Å

PDB Description: 28kda glutathione s-transferase from schistosoma haematobium (glutathione saturated)

SCOP Domain Sequences for d1oe8b2:

Sequence; same for both SEQRES and ATOM records:

>d1oe8b2 c.47.1.5 (B:3-84) Class alpha GST {Blood fluke (Schistosoma haematobium)}
gdhikviyfngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitdnh
ghvkwmveslaiarymakkhhm

Timeline for d1oe8b2:

• d1oe8b2 is new in SCOP 1.65
  
• d1oe8b2 appears in SCOP 1.67
  
• d1oe8b2 appears in the current release, SCOPe 2.08