| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Class alpha GST [81349] (8 species) |
| Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89060] (4 PDB entries) |
| Domain d1oe8b1: 1oe8 B:85-207 [86907] Other proteins in same PDB: d1oe8a2, d1oe8b2 complexed with gsh |
PDB Entry: 1oe8 (more details), 1.65 Å
SCOPe Domain Sequences for d1oe8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oe8b1 a.45.1.1 (B:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk
astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls
dra
Timeline for d1oe8b1: