SCOP 1.65: Domain d1oe8b1: 1oe8 B:85-207

Lineage for d1oe8b1 (1oe8 B:85-207)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89060] (2 PDB entries)

8. Domain d1oe8b1: 1oe8 B:85-207 [86907]
   Other proteins in same PDB: d1oe8a2, d1oe8b2
   complexed with gsh

Details for d1oe8b1

PDB Entry: 1oe8, 1.65 Å

PDB Description: 28kda glutathione s-transferase from schistosoma haematobium (glutathione saturated)

SCOP Domain Sequences for d1oe8b1:

Sequence; same for both SEQRES and ATOM records:

>d1oe8b1 a.45.1.1 (B:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium)}
mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk
astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls
dra

Timeline for d1oe8b1:

• d1oe8b1 is new in SCOP 1.65
  
• d1oe8b1 appears in SCOP 1.67
  
• d1oe8b1 appears in the current release, SCOPe 2.08