Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (14 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins) |
Protein Class alpha GST [81360] (8 species) |
Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89704] (2 PDB entries) |
Domain d1oe8a2: 1oe8 A:4-84 [86906] Other proteins in same PDB: d1oe8a1, d1oe8b1 |
PDB Entry: 1oe8 (more details), 1.65 Å
SCOP Domain Sequences for d1oe8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium)} dhikviyfngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg hvkwmveslaiarymakkhhm
Timeline for d1oe8a2: