Lineage for d1oe8a2 (1oe8 A:4-84)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315307Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 315308Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 315468Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)
  6. 315477Protein Class alpha GST [81360] (8 species)
  7. 315478Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89704] (2 PDB entries)
  8. 315479Domain d1oe8a2: 1oe8 A:4-84 [86906]
    Other proteins in same PDB: d1oe8a1, d1oe8b1

Details for d1oe8a2

PDB Entry: 1oe8 (more details), 1.65 Å

PDB Description: 28kda glutathione s-transferase from schistosoma haematobium (glutathione saturated)

SCOP Domain Sequences for d1oe8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium)}
dhikviyfngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg
hvkwmveslaiarymakkhhm

SCOP Domain Coordinates for d1oe8a2:

Click to download the PDB-style file with coordinates for d1oe8a2.
(The format of our PDB-style files is described here.)

Timeline for d1oe8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oe8a1