Lineage for d1oe7b2 (1oe7 B:5-84)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852841Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1852852Protein Class alpha GST [81360] (8 species)
  7. 1852853Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89704] (4 PDB entries)
  8. 1852857Domain d1oe7b2: 1oe7 B:5-84 [86904]
    Other proteins in same PDB: d1oe7a1, d1oe7b1
    complexed with gsh

Details for d1oe7b2

PDB Entry: 1oe7 (more details), 1.8 Å

PDB Description: 28kda glutathione s-transferase from schistosoma haematobium
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1oe7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oe7b2 c.47.1.5 (B:5-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
hikviyfngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhgh
vkwmveslaiarymakkhhm

SCOPe Domain Coordinates for d1oe7b2:

Click to download the PDB-style file with coordinates for d1oe7b2.
(The format of our PDB-style files is described here.)

Timeline for d1oe7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oe7b1