SCOPe 2.05: Domain d1oe6a_: 1oe6 A:

Lineage for d1oe6a_ (1oe6 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.3: Single-strand selective monofunctional uracil-DNA glycosylase SMUG1 [89579] (1 protein)

6. Protein Single-strand selective monofunctional uracil-DNA glycosylase SMUG1 [89580] (1 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [89581] (3 PDB entries)

8. Domain d1oe6a_: 1oe6 A: [86899]
   protein/DNA complex; complexed with gol, hmu, ipa

Details for d1oe6a_

PDB Entry: 1oe6, 2.65 Å

PDB Description: Xenopus SMUG1, an anti-mutator uracil-DNA Glycosylase

PDB Compounds: (A:) single-strand selective monofunctional uracil DNA glycosylase

SCOPe Domain Sequences for d1oe6a_:

Sequence; same for both SEQRES and ATOM records:

>d1oe6a_ c.18.1.3 (A:) Single-strand selective monofunctional uracil-DNA glycosylase SMUG1 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
spadsflkvelelnlklsnlvfqdpvqyvynplvyawaphenyvqtyckskkevlflgmn
pgpfgmaqtgvpfgevnhvrdwlqiegpvskpevehpkrrirgfecpqsevsgarfwslf
kslcgqpetffkhcfvhnhcplifmnhsgknltptdlpkaqrdtlleicdealcqavrvl
gvklvigvgrfseqrarkalmaegidvtvkgimhpsprnpqankgwegivrgqllelgvl
sllt

Timeline for d1oe6a_:

• d1oe6a_ first appeared in SCOP 1.65
  
• d1oe6a_ appears in SCOPe 2.04
  
• d1oe6a_ appears in SCOPe 2.06
  
• d1oe6a_ appears in the current release, SCOPe 2.08