Lineage for d1oe6a_ (1oe6 A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691382Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 691383Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (3 families) (S)
  5. 691442Family c.18.1.3: Single-strand selective monofunctional uracil-DNA glycosylase SMUG1 [89579] (1 protein)
  6. 691443Protein Single-strand selective monofunctional uracil-DNA glycosylase SMUG1 [89580] (1 species)
  7. 691444Species African clawed frog (Xenopus laevis) [TaxId:8355] [89581] (3 PDB entries)
  8. 691449Domain d1oe6a_: 1oe6 A: [86899]

Details for d1oe6a_

PDB Entry: 1oe6 (more details), 2.65 Å

PDB Description: Xenopus SMUG1, an anti-mutator uracil-DNA Glycosylase
PDB Compounds: (A:) single-strand selective monofunctional uracil DNA glycosylase

SCOP Domain Sequences for d1oe6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oe6a_ c.18.1.3 (A:) Single-strand selective monofunctional uracil-DNA glycosylase SMUG1 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
spadsflkvelelnlklsnlvfqdpvqyvynplvyawaphenyvqtyckskkevlflgmn
pgpfgmaqtgvpfgevnhvrdwlqiegpvskpevehpkrrirgfecpqsevsgarfwslf
kslcgqpetffkhcfvhnhcplifmnhsgknltptdlpkaqrdtlleicdealcqavrvl
gvklvigvgrfseqrarkalmaegidvtvkgimhpsprnpqankgwegivrgqllelgvl
sllt

SCOP Domain Coordinates for d1oe6a_:

Click to download the PDB-style file with coordinates for d1oe6a_.
(The format of our PDB-style files is described here.)

Timeline for d1oe6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1oe6b_