SCOPe 2.06: Domain d1oe5b_: 1oe5 B:

Lineage for d1oe5b_ (1oe5 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.3: Single-strand selective monofunctional uracil-DNA glycosylase SMUG1 [89579] (1 protein)

6. Protein Single-strand selective monofunctional uracil-DNA glycosylase SMUG1 [89580] (1 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [89581] (3 PDB entries)

8. Domain d1oe5b_: 1oe5 B: [86898]
   protein/DNA complex; complexed with dur, epe, gol, ipa, ura

Details for d1oe5b_

PDB Entry: 1oe5, 2.3 Å

PDB Description: Xenopus SMUG1, an anti-mutator uracil-DNA Glycosylase

PDB Compounds: (B:) single-strand selective monofunctional uracil DNA glycosylase

SCOPe Domain Sequences for d1oe5b_:

Sequence; same for both SEQRES and ATOM records:

>d1oe5b_ c.18.1.3 (B:) Single-strand selective monofunctional uracil-DNA glycosylase SMUG1 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
espadsflkvelelnlklsnlvfqdpvqyvynplvyawaphenyvqtyckskkevlflgm
npgpfgmaqtgvpfgevnhvrdwlqiegpvskpevehpkrrirgfecpqsevsgarfwsl
fkslcgqpetffkhcfvhnhcplifmnhsgknltptdlpkaqrdtlleicdealcqavrv
lgvklvigvgrfseqrarkalmaegidvtvkgimhpsprnpqankgwegivrgqllelgv
lsllt

Timeline for d1oe5b_:

• d1oe5b_ first appeared in SCOP 1.65
  
• d1oe5b_ appears in SCOPe 2.05
  
• d1oe5b_ appears in SCOPe 2.07
  
• d1oe5b_ appears in the current release, SCOPe 2.08