Lineage for d1oe5a_ (1oe5 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114317Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2114318Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2114412Family c.18.1.3: Single-strand selective monofunctional uracil-DNA glycosylase SMUG1 [89579] (1 protein)
  6. 2114413Protein Single-strand selective monofunctional uracil-DNA glycosylase SMUG1 [89580] (1 species)
  7. 2114414Species African clawed frog (Xenopus laevis) [TaxId:8355] [89581] (3 PDB entries)
  8. 2114417Domain d1oe5a_: 1oe5 A: [86897]
    protein/DNA complex; complexed with dur, epe, gol, ipa, ura

Details for d1oe5a_

PDB Entry: 1oe5 (more details), 2.3 Å

PDB Description: Xenopus SMUG1, an anti-mutator uracil-DNA Glycosylase
PDB Compounds: (A:) single-strand selective monofunctional uracil DNA glycosylase

SCOPe Domain Sequences for d1oe5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oe5a_ c.18.1.3 (A:) Single-strand selective monofunctional uracil-DNA glycosylase SMUG1 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
spadsflkvelelnlklsnlvfqdpvqyvynplvyawaphenyvqtyckskkevlflgmn
pgpfgmaqtgvpfgevnhvrdwlqiegpvskpevehpkrrirgfecpqsevsgarfwslf
kslcgqpetffkhcfvhnhcplifmnhsgknltptdlpkaqrdtlleicdealcqavrvl
gvklvigvgrfseqrarkalmaegidvtvkgimhpsprnpqankgwegivrgqllelgvl
sllt

SCOPe Domain Coordinates for d1oe5a_:

Click to download the PDB-style file with coordinates for d1oe5a_.
(The format of our PDB-style files is described here.)

Timeline for d1oe5a_: