SCOP 1.65: Domain d1oe4b_: 1oe4 B:

Lineage for d1oe4b_ (1oe4 B:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.18: DNA glycosylase [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: DNA glycosylase [52141] (3 families)

5. Family c.18.1.3: Single-strand selective monofunctional uracil-DNA glycosylase SMUG1 [89579] (1 protein)

6. Protein Single-strand selective monofunctional uracil-DNA glycosylase SMUG1 [89580] (1 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [89581] (3 PDB entries)

8. Domain d1oe4b_: 1oe4 B: [86896]
   complexed with gol, ipa; mutant

Details for d1oe4b_

PDB Entry: 1oe4, 2 Å

PDB Description: Xenopus SMUG1, an anti-mutator uracil-DNA Glycosylase

SCOP Domain Sequences for d1oe4b_:

Sequence; same for both SEQRES and ATOM records:

>d1oe4b_ c.18.1.3 (B:) Single-strand selective monofunctional uracil-DNA glycosylase SMUG1 {African clawed frog (Xenopus laevis)}
espadsflkvelelnlklsnlvfqdpvqyvynplvyawaphenyvqtyckskkevlflgm
npgpfgmaqtgvpfgevnhvrdwlqiegpvskpevehpkrrirgfecpqsevsgarfwsl
fkslcgqpetffkhcfvhnhcplifmnhsgknltptdlpkaqrdtlleicdealcqavrv
lgvklvigvgrfseqrarkalmaegidvtvkgimhpsprnpqankgwegivrgqllelgv
lsllt

Timeline for d1oe4b_:

• d1oe4b_ is new in SCOP 1.65
  
• d1oe4b_ appears in SCOP 1.67
  
• d1oe4b_ appears in the current release, SCOPe 2.08