SCOP 1.71: Domain d1odvb_: 1odv B:

Lineage for d1odvb_ (1odv B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (2 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Ectothiorhodospira halophila [TaxId:17] [55788] (27 PDB entries)

8. Domain d1odvb_: 1odv B: [86888]
   1-25 deletion mutant

Details for d1odvb_

PDB Entry: 1odv, 1.14 Å

PDB Description: photoactive yellow protein 1-25 deletion mutant

SCOP Domain Sequences for d1odvb_:

Sequence; same for both SEQRES and ATOM records:

>d1odvb_ d.110.3.1 (B:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
lafgaiqldgdgnilqynaaegditgrdpkqvigknffkdvapctdspefygkfkegvas
gnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvkrv

Timeline for d1odvb_:

• d1odvb_ first appeared in SCOP 1.65
  
• d1odvb_ appears in SCOP 1.69
  
• d1odvb_ appears in SCOP 1.73
  
• d1odvb_ appears in the current release, SCOPe 2.08