Lineage for d1odvb_ (1odv B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 333260Fold d.110: Profilin-like [55769] (5 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 333317Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (4 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 333318Family d.110.3.1: PYP-like [55786] (2 proteins)
  6. 333319Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 333320Species Ectothiorhodospira halophila [TaxId:17] [55788] (14 PDB entries)
  8. 333335Domain d1odvb_: 1odv B: [86888]
    1-25 deletion mutant

Details for d1odvb_

PDB Entry: 1odv (more details), 1.14 Å

PDB Description: photoactive yellow protein 1-25 deletion mutant

SCOP Domain Sequences for d1odvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1odvb_ d.110.3.1 (B:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
lafgaiqldgdgnilqynaaegditgrdpkqvigknffkdvapctdspefygkfkegvas
gnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvkrv

SCOP Domain Coordinates for d1odvb_:

Click to download the PDB-style file with coordinates for d1odvb_.
(The format of our PDB-style files is described here.)

Timeline for d1odvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1odva_