SCOPe 2.05: Domain d1odtc_: 1odt C:

Lineage for d1odtc_ (1odt C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
   Pfam PF05448; AXE1

6. Protein Cephalosporin C deacetylase [82505] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [82506] (3 PDB entries)

8. Domain d1odtc_: 1odt C: [86885]
   complexed with act

Details for d1odtc_

PDB Entry: 1odt, 1.7 Å

PDB Description: cephalosporin c deacetylase mutated, in complex with acetate

PDB Compounds: (C:) Cephalosporin C deacetylase

SCOPe Domain Sequences for d1odtc_:

Sequence; same for both SEQRES and ATOM records:

>d1odtc_ c.69.1.25 (C:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}
mqlfdlpldqlqtykpektapkdfsefwklsleelakvqaepdlqpvdypadgvkvyrlt
yksfgnaritgwyavpdkegphpaivkyhgynasydgeihemvnwalhgyatfgmlvrgq
qssedtsisphghalgwmtkgildkdtyyyrgvyldavralevissfdevdetrigvtgg
aqgggltiaaaalsdipkaavadypylsnferaidvaleepyleinsffrrngspetevq
amktlsyfdimnladrvkvpvlmsiglidkvtppstvfaaynhletkkelkvyryfghey
ipafqteklaffkqhlk

Timeline for d1odtc_:

• d1odtc_ first appeared in SCOP 1.65
  
• d1odtc_ appears in SCOPe 2.04
  
• d1odtc_ appears in SCOPe 2.06
  
• d1odtc_ appears in the current release, SCOPe 2.08