Lineage for d1odsh_ (1ods H:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1002544Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1002545Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1003800Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
    Pfam PF05448; AXE1
  6. 1003815Protein Cephalosporin C deacetylase [82505] (1 species)
  7. 1003816Species Bacillus subtilis [TaxId:1423] [82506] (3 PDB entries)
  8. 1003828Domain d1odsh_: 1ods H: [86884]
    complexed with cl, mg

Details for d1odsh_

PDB Entry: 1ods (more details), 1.9 Å

PDB Description: cephalosporin c deacetylase from bacillus subtilis
PDB Compounds: (H:) Cephalosporin C deacetylase

SCOPe Domain Sequences for d1odsh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1odsh_ c.69.1.25 (H:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}
qlfdlpldqlqtykpektapkdfsefwklsleelakvqaepdlqpvdypadgvkvyrlty
ksfgnaritgwyavpdkegphpaivkyhgynasydgeihemvnwalhgyatfgmlvrgqq
ssedtsisphghalgwmtkgildkdtyyyrgvyldavralevissfdevdetrigvtggs
qgggltiaaaalsdipkaavadypylsnferaidvaleepyleinsffrrngspetevqa
mktlsyfdimnlayrvkvpvlmsiglidkvtppstvfaaynhletkkelkvyryfgheyi
pafqteklaffkqhlk

SCOPe Domain Coordinates for d1odsh_:

Click to download the PDB-style file with coordinates for d1odsh_.
(The format of our PDB-style files is described here.)

Timeline for d1odsh_: