Lineage for d1odsd_ (1ods D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901488Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
    Pfam PF05448; AXE1
  6. 2901527Protein Cephalosporin C deacetylase [82505] (1 species)
  7. 2901528Species Bacillus subtilis [TaxId:1423] [82506] (3 PDB entries)
  8. 2901534Domain d1odsd_: 1ods D: [86880]
    complexed with cl, mg

Details for d1odsd_

PDB Entry: 1ods (more details), 1.9 Å

PDB Description: cephalosporin c deacetylase from bacillus subtilis
PDB Compounds: (D:) Cephalosporin C deacetylase

SCOPe Domain Sequences for d1odsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1odsd_ c.69.1.25 (D:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}
qlfdlpldqlqtykpektapkdfsefwklsleelakvqaepdlqpvdypadgvkvyrlty
ksfgnaritgwyavpdkegphpaivkyhgynasydgeihemvnwalhgyatfgmlvrgqq
ssedtsisphghalgwmtkgildkdtyyyrgvyldavralevissfdevdetrigvtggs
qgggltiaaaalsdipkaavadypylsnferaidvaleepyleinsffrrngspetevqa
mktlsyfdimnlayrvkvpvlmsiglidkvtppstvfaaynhletkkelkvyryfgheyi
pafqteklaffkqhlk

SCOPe Domain Coordinates for d1odsd_:

Click to download the PDB-style file with coordinates for d1odsd_.
(The format of our PDB-style files is described here.)

Timeline for d1odsd_: