SCOP 1.73: Domain d1odsc_: 1ods C:

Lineage for d1odsc_ (1ods C:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.25: Acetyl xylan esterase-like [82504] (2 proteins)
   Pfam PF05448; AXE1

6. Protein Cephalosporin C deacetylase [82505] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [82506] (3 PDB entries)

8. Domain d1odsc_: 1ods C: [86879]

Details for d1odsc_

PDB Entry: 1ods, 1.9 Å

PDB Description: cephalosporin c deacetylase from bacillus subtilis

PDB Compounds: (C:) Cephalosporin C deacetylase

SCOP Domain Sequences for d1odsc_:

Sequence; same for both SEQRES and ATOM records:

>d1odsc_ c.69.1.25 (C:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}
qlfdlpldqlqtykpektapkdfsefwklsleelakvqaepdlqpvdypadgvkvyrlty
ksfgnaritgwyavpdkegphpaivkyhgynasydgeihemvnwalhgyatfgmlvrgqq
ssedtsisphghalgwmtkgildkdtyyyrgvyldavralevissfdevdetrigvtggs
qgggltiaaaalsdipkaavadypylsnferaidvaleepyleinsffrrngspetevqa
mktlsyfdimnlayrvkvpvlmsiglidkvtppstvfaaynhletkkelkvyryfgheyi
pafqteklaffkqhlk

Timeline for d1odsc_:

• d1odsc_ first appeared in SCOP 1.65
  
• d1odsc_ appears in SCOP 1.71
  
• d1odsc_ appears in SCOP 1.75
  
• d1odsc_ appears in the current release, SCOPe 2.08