Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.25: Acetyl xylan esterase-like [82504] (2 proteins) Pfam PF05448; AXE1 |
Protein Cephalosporin C deacetylase [82505] (1 species) |
Species Bacillus subtilis [TaxId:1423] [82506] (3 PDB entries) |
Domain d1odsc_: 1ods C: [86879] |
PDB Entry: 1ods (more details), 1.9 Å
SCOP Domain Sequences for d1odsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1odsc_ c.69.1.25 (C:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} qlfdlpldqlqtykpektapkdfsefwklsleelakvqaepdlqpvdypadgvkvyrlty ksfgnaritgwyavpdkegphpaivkyhgynasydgeihemvnwalhgyatfgmlvrgqq ssedtsisphghalgwmtkgildkdtyyyrgvyldavralevissfdevdetrigvtggs qgggltiaaaalsdipkaavadypylsnferaidvaleepyleinsffrrngspetevqa mktlsyfdimnlayrvkvpvlmsiglidkvtppstvfaaynhletkkelkvyryfgheyi pafqteklaffkqhlk
Timeline for d1odsc_: