SCOPe 2.06: Domain d1odke_: 1odk E:

Lineage for d1odke_ (1odk E:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (13 species)

7. Species Thermus thermophilus [TaxId:274] [89721] (4 PDB entries)

8. Domain d1odke_: 1odk E: [86867]
   complexed with gol

Details for d1odke_

PDB Entry: 1odk, 1.9 Å

PDB Description: purine nucleoside phosphorylase from thermus thermophilus

PDB Compounds: (E:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d1odke_:

Sequence, based on SEQRES records:

>d1odke_ c.56.2.1 (E:) Purine nucleoside phosphorylase, PNP {Thermus thermophilus [TaxId: 274]}
spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev

Sequence, based on observed residues (ATOM records):

>d1odke_ c.56.2.1 (E:) Purine nucleoside phosphorylase, PNP {Thermus thermophilus [TaxId: 274]}
spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
asalfllgrmrgvrtgailavsnrievlqegvrrmvevaleavlev

Timeline for d1odke_:

• d1odke_ first appeared in SCOP 1.65
  
• d1odke_ appears in SCOPe 2.05
  
• d1odke_ appears in SCOPe 2.07
  
• d1odke_ appears in the current release, SCOPe 2.08