Lineage for d1odkc_ (1odk C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 587177Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 587193Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 587194Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)
  6. 587281Protein Purine nucleoside phosphorylase, PNP [53169] (9 species)
  7. 587413Species Thermus thermophilus [TaxId:274] [89721] (4 PDB entries)
  8. 587416Domain d1odkc_: 1odk C: [86865]

Details for d1odkc_

PDB Entry: 1odk (more details), 1.9 Å

PDB Description: purine nucleoside phosphorylase from thermus thermophilus

SCOP Domain Sequences for d1odkc_:

Sequence, based on SEQRES records: (download)

>d1odkc_ c.56.2.1 (C:) Purine nucleoside phosphorylase, PNP {Thermus thermophilus}
spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev

Sequence, based on observed residues (ATOM records): (download)

>d1odkc_ c.56.2.1 (C:) Purine nucleoside phosphorylase, PNP {Thermus thermophilus}
spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
asalfllgrmrgvrtgailavsnrippevlqegvrrmvevaleavlev

SCOP Domain Coordinates for d1odkc_:

Click to download the PDB-style file with coordinates for d1odkc_.
(The format of our PDB-style files is described here.)

Timeline for d1odkc_: