Lineage for d1odjd_ (1odj D:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 996821Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 996837Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 996838Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 996948Protein Purine nucleoside phosphorylase, PNP [53169] (10 species)
  7. 997110Species Thermus thermophilus [TaxId:274] [89721] (4 PDB entries)
  8. 997132Domain d1odjd_: 1odj D: [86860]
    complexed with gmp, so4

Details for d1odjd_

PDB Entry: 1odj (more details), 2.4 Å

PDB Description: purine nucleoside phosphorylase from thermus thermophilus
PDB Compounds: (D:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d1odjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1odjd_ c.56.2.1 (D:) Purine nucleoside phosphorylase, PNP {Thermus thermophilus [TaxId: 274]}
spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev

SCOPe Domain Coordinates for d1odjd_:

Click to download the PDB-style file with coordinates for d1odjd_.
(The format of our PDB-style files is described here.)

Timeline for d1odjd_: