Lineage for d1odic_ (1odi C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2140829Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2140830Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2140946Protein Purine nucleoside phosphorylase, PNP [53169] (13 species)
  7. 2141191Species Thermus thermophilus [TaxId:274] [89721] (4 PDB entries)
  8. 2141206Domain d1odic_: 1odi C: [86853]
    complexed with adn, so4

Details for d1odic_

PDB Entry: 1odi (more details), 2.4 Å

PDB Description: purine nucleoside phosphorylase from thermus thermophilus
PDB Compounds: (C:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d1odic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1odic_ c.56.2.1 (C:) Purine nucleoside phosphorylase, PNP {Thermus thermophilus [TaxId: 274]}
spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev

SCOPe Domain Coordinates for d1odic_:

Click to download the PDB-style file with coordinates for d1odic_.
(The format of our PDB-style files is described here.)

Timeline for d1odic_: