SCOP 1.65: Domain d1odib_: 1odi B:

Lineage for d1odib_ (1odi B:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (4 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (6 species)

7. Species Thermus thermophilus [TaxId:274] [89721] (4 PDB entries)

8. Domain d1odib_: 1odi B: [86852]

Details for d1odib_

PDB Entry: 1odi, 2.4 Å

PDB Description: purine nucleoside phosphorylase from thermus thermophilus

SCOP Domain Sequences for d1odib_:

Sequence; same for both SEQRES and ATOM records:

>d1odib_ c.56.2.1 (B:) Purine nucleoside phosphorylase, PNP {Thermus thermophilus}
spihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvq
ttgmgtpsaaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqyle
grpyapvpdpevfralwrraealgyphrvglvasedafyattpeearawarygvlafeme
asalfllgrmrgvrtgailavsnrigdpelappevlqegvrrmvevaleavlev

Timeline for d1odib_:

• d1odib_ is new in SCOP 1.65
  
• d1odib_ appears in SCOP 1.67
  
• d1odib_ appears in the current release, SCOPe 2.08