![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) ![]() |
![]() | Family c.52.1.15: Very short patch repair (VSR) endonuclease [53023] (1 protein) |
![]() | Protein Very short patch repair (VSR) endonuclease [53024] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [53025] (3 PDB entries) |
![]() | Domain d1odga_: 1odg A: [86849] bound to the reaction product site complexed with zn |
PDB Entry: 1odg (more details), 2.8 Å
SCOPe Domain Sequences for d1odga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1odga_ c.52.1.15 (A:) Very short patch repair (VSR) endonuclease {Escherichia coli [TaxId: 562]} aiekrlaslltgqglafrvqdaslpgrpdfvvdeyrcvifthgcfwhhhhcylfkvpatr tefwlekigknverdrrdisrlqelgwrvlivwecalrgrekltdealterleewicgeg asaqidtqgihlla
Timeline for d1odga_: