Lineage for d1odeb_ (1ode B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865651Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 865652Superfamily d.79.1: YjgF-like [55298] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 865749Family d.79.1.2: Chorismate mutase [55304] (1 protein)
  6. 865750Protein Chorismate mutase [55305] (3 species)
  7. 865797Species Thermus thermophilus [TaxId:274] [89981] (3 PDB entries)
  8. 865801Domain d1odeb_: 1ode B: [86847]

Details for d1odeb_

PDB Entry: 1ode (more details), 1.65 Å

PDB Description: crystal analysis of chorismate mutase from thermus thermophilus.
PDB Compounds: (B:) chorismate mutase

SCOP Domain Sequences for d1odeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1odeb_ d.79.1.2 (B:) Chorismate mutase {Thermus thermophilus [TaxId: 274]}
mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrp

SCOP Domain Coordinates for d1odeb_:

Click to download the PDB-style file with coordinates for d1odeb_.
(The format of our PDB-style files is described here.)

Timeline for d1odeb_: