Lineage for d1odea_ (1ode A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565346Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2565480Family d.79.1.2: Chorismate mutase [55304] (1 protein)
    automatically mapped to Pfam PF07736
  6. 2565481Protein Chorismate mutase [55305] (3 species)
  7. 2565552Species Thermus thermophilus [TaxId:274] [89981] (3 PDB entries)
  8. 2565555Domain d1odea_: 1ode A: [86846]

Details for d1odea_

PDB Entry: 1ode (more details), 1.65 Å

PDB Description: crystal analysis of chorismate mutase from thermus thermophilus.
PDB Compounds: (A:) chorismate mutase

SCOPe Domain Sequences for d1odea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1odea_ d.79.1.2 (A:) Chorismate mutase {Thermus thermophilus [TaxId: 274]}
mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpd

SCOPe Domain Coordinates for d1odea_:

Click to download the PDB-style file with coordinates for d1odea_.
(The format of our PDB-style files is described here.)

Timeline for d1odea_: