SCOPe 2.05: Domain d1odea_: 1ode A:

Lineage for d1odea_ (1ode A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (3 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.2: Chorismate mutase [55304] (1 protein)
   automatically mapped to Pfam PF07736

6. Protein Chorismate mutase [55305] (3 species)

7. Species Thermus thermophilus [TaxId:274] [89981] (3 PDB entries)

8. Domain d1odea_: 1ode A: [86846]

Details for d1odea_

PDB Entry: 1ode, 1.65 Å

PDB Description: crystal analysis of chorismate mutase from thermus thermophilus.

PDB Compounds: (A:) chorismate mutase

SCOPe Domain Sequences for d1odea_:

Sequence; same for both SEQRES and ATOM records:

>d1odea_ d.79.1.2 (A:) Chorismate mutase {Thermus thermophilus [TaxId: 274]}
mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltsafpae
aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpd

Timeline for d1odea_:

• d1odea_ first appeared in SCOP 1.65
  
• d1odea_ appears in SCOPe 2.04
  
• d1odea_ appears in SCOPe 2.06
  
• d1odea_ appears in the current release, SCOPe 2.08