Lineage for d1odbe_ (1odb E:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280804Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 280805Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 280828Family a.39.1.2: S100 proteins [47478] (1 protein)
    dimer: subunits are made of two EF-hands
  6. 280829Protein Calcyclin (S100) [47479] (16 species)
  7. 280834Species Human (Homo sapiens), calgranulin C, s100a12 [TaxId:9606] [47488] (3 PDB entries)
  8. 280841Domain d1odbe_: 1odb E: [86844]

Details for d1odbe_

PDB Entry: 1odb (more details), 2.19 Å

PDB Description: the crystal structure of human s100a12 - copper complex
PDB Compounds: (E:)

SCOP Domain Sequences for d1odbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1odbe_ a.39.1.2 (E:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12}
stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
ldanqdeqvdfqefislvaialkaahyhthk

SCOP Domain Coordinates for d1odbe_:

Click to download the PDB-style file with coordinates for d1odbe_.
(The format of our PDB-style files is described here.)

Timeline for d1odbe_: