Lineage for d1odbb_ (1odb B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1733398Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1733399Protein Calcyclin (S100) [47479] (17 species)
  7. 1733435Species Human (Homo sapiens), calgranulin C, s100a12 [TaxId:9606] [47488] (3 PDB entries)
  8. 1733439Domain d1odbb_: 1odb B: [86841]
    complexed with ca, cu

Details for d1odbb_

PDB Entry: 1odb (more details), 2.19 Å

PDB Description: the crystal structure of human s100a12 - copper complex
PDB Compounds: (B:) calgranulin c

SCOPe Domain Sequences for d1odbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1odbb_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]}
stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
ldanqdeqvdfqefislvaialkaahyhthk

SCOPe Domain Coordinates for d1odbb_:

Click to download the PDB-style file with coordinates for d1odbb_.
(The format of our PDB-style files is described here.)

Timeline for d1odbb_: