SCOP 1.67: Domain d1odbb_: 1odb B:

Lineage for d1odbb_ (1odb B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (1 protein)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (16 species)

7. Species Human (Homo sapiens), calgranulin C, s100a12 [TaxId:9606] [47488] (3 PDB entries)

8. Domain d1odbb_: 1odb B: [86841]

Details for d1odbb_

PDB Entry: 1odb, 2.19 Å

PDB Description: the crystal structure of human s100a12 - copper complex

SCOP Domain Sequences for d1odbb_:

Sequence; same for both SEQRES and ATOM records:

>d1odbb_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12}
stkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqg
ldanqdeqvdfqefislvaialkaahyhthk

Timeline for d1odbb_:

• d1odbb_ first appeared in SCOP 1.65
  
• d1odbb_ appears in SCOP 1.69
  
• d1odbb_ appears in the current release, SCOPe 2.08, called d1odbb1